PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10434028g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 320aa    MW: 36085.6 Da    PI: 6.2484
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10434028g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21e-142370148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd +l++++++ G g+W+  a+  g++R++k+c++rw +yl
  MA_10434028g0010 23 KGPWTLEEDMRLIHYITLRGEGRWNFLAKAAGLKRSGKSCRLRWVNYL 70
                      79********************************************97 PP

2Myb_DNA-binding48.52e-1576119146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg  T+eE+ l++d+  ++G++ W++Ia++++ gRt++++k++w++
  MA_10434028g0010  76 RGDITPEEERLIIDLQGRWGNR-WSRIAKKLP-GRTDNEIKNYWRT 119
                       6788******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.9891870IPR017930Myb domain
SuperFamilySSF466891.45E-2822117IPR009057Homeodomain-like
SMARTSM007173.9E-112272IPR001005SANT/Myb domain
PfamPF002495.0E-132370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-212477IPR009057Homeodomain-like
CDDcd001672.36E-82570No hitNo description
PROSITE profilePS5129425.88571125IPR017930Myb domain
SMARTSM007178.2E-1575123IPR001005SANT/Myb domain
PfamPF002491.7E-1376119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2378125IPR009057Homeodomain-like
CDDcd001673.75E-1180119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MTTRSGLSVA AMFKQEEVEI MRKGPWTLEE DMRLIHYITL RGEGRWNFLA KAAGLKRSGK  60
SCRLRWVNYL RPDLKRGDIT PEEERLIIDL QGRWGNRWSR IAKKLPGRTD NEIKNYWRTR  120
IKKKILENNH CGNQFLEHEM CSSSFLNPLM QKSGPEEATP TSTNWGGTGT MQINRNTLVH  180
FDQLPVNSPI TGFDTGFVNS IVSNNGNDDV HSSTGEIVDA WKTIYGHHTL SLSRFEHGKG  240
GPAIVDILPH NDADLPLEID SFMASLSEFQ AEKTVLEEAV SSSSFSSLDG LEGILSQSNL  300
TDGETLWTSD SKWNVEFAQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-262112525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6QR058e-85A0A0D6QR05_ARACU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.16e-56myb domain protein 24